FanFiction.Net - Danny Phantom, Last Updated, English,

An Unfortunate Choice of Words

2009-12-03T00:45:58-08:00

Author: A Poor Player
Category: Danny Phantom
Language: English, Rated: T
Genres: Horror/Humor
Pairing: Sam M. & Danny F.
Chapters: 1, Words: 799, Reviews: 1 Published: 12-3-09
Status: In-Progress

After wishing to be in a horror movie, Sam realizes that this is a lesson she should have already learned.

Whoa Dude Chat!

2009-12-02T20:54:45-08:00

Author: Mischievia SamanthaFenton
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/Romance
Pairing: Danny F.
Chapters: 1, Words: 1,103, Reviews: 3 Published: 12-2-09
Status: In-Progress

Takes place in my other story, Whoa Dude! Almost the whole gang's here, and it'll be hilarious. Come read what they say, without them catching you! NO FLAMES! DxOC

A Hero's Work is Never Done

2009-12-02T20:26:01-08:00

Author: siskiebusiness
Category: Danny Phantom
Language: English, Rated: K
Genres: Hurt/Comfort/Friendship
Pairing: Danny F. & Lancer
Chapters: 1, Words: 1,771, Reviews: 0 Published: 12-2-09
Status: Complete

When the stress becomes to much for Danny, will he be able to keep his secret or will Lancer find out who Phantom is?

The Oneshot Theater

2009-12-02T19:46:12-08:00

Author: Sai What You Know
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F.
Chapters: 5, Words: 8,218, Reviews: 0 Updated: 12-2-09 Published: 11-24-09
Status: In-Progress

A collection of oneshots that i may/may not allow other to adopt. May continue a few as well. Currently Peforming; 'Memories' "Shut up." "Get up then." "Your name is...?" "He's British, as far as I can tell."

Dark Rebirth

2009-12-02T18:43:07-08:00

Author: Foresaken Beast
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Supernatural
Pairing: Danny F. & Sam M.
Chapters: 3, Words: 6,733, Reviews: 4 Updated: 12-2-09 Published: 11-27-09
Status: In-Progress

The king of Ghosts has returned, threatening to crush his eneimes before his awesome might. There is only one being in existance that can stop him and his reign of terror. Too bad he's only sixteen. Pre Season 3 of the series.

A Christmas Sonnet

2009-12-02T17:55:37-08:00

Author: Sparteen
Category: Danny Phantom
Language: English, Rated: K+
Genres: Poetry/Humor
Pairing: Vlad M.
Chapters: 1, Words: 737, Reviews: 2 Published: 12-2-09
Status: In-Progress

What happens when Ghostwriter's niece decides to write a Christmas poem about Vlad? An unforgettable holiday for our favorite Fruit Loop. My first fanfic, please R&R. No flames please.

Christmastime Is Here

2009-12-02T16:15:26-08:00

Author: Smiley-Nami
Category: Danny Phantom
Language: English, Rated: K
Genres: Friendship/Family
Pairing: Danny F.
Chapters: 1, Words: 654, Reviews: 0 Published: 12-2-09
Status: Complete

Emily talks to Danny about Christmas and also sings a chorus from a song to Danny.

Turn Off the Lights

2009-12-02T10:04:59-08:00

Author: CodyRhodesFan
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Angst
Pairing: Jazz F. & Vlad M.
Chapters: 1, Words: 1,136, Reviews: 1 Published: 12-2-09
Status: In-Progress

Vlad gets Desiree to wish him younger and now, a 20 year old ‘college student’ has to do a report on the school. Since Danny doesn’t know him, he can kill him but when he sees Jazz playing the flute in music class, sparks fly. Jazz/Vlad. PSYCHO CEREAL!

Shipwrecked

2009-12-02T02:53:18-08:00

Author: Looka'sMagicHell
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Romance
Pairing: Sam M. & Danny F.
Chapters: 4, Words: 9,339, Reviews: 8 Updated: 12-2-09 Published: 11-27-09
Status: In-Progress

I'm Sam Manson. Me and seven other people went on a school cruise, only to get stuck in a thunderstorm. We crashed on an island with no location on a map, and no history. Oh, and have I mentioned there are dinosaurs on this island?

Like Father, Like Daughter

2009-12-01T20:46:57-08:00

Author: Miss. Creativity
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Family
Pairing: Sam M.
Chapters: 11, Words: 16,881, Reviews: 48 Updated: 12-1-09 Published: 5-15-09
Status: In-Progress

Danny and Sam broke up & she felt that she has nothing to remind her of Danny except their daughter, Lillith. Sam married Tucker. Tucker believed for 14 years that Lilly was his. But how does Sam explain that your daughter has ghost powers?

Alice

2009-12-01T20:21:33-08:00

Author: Heart-broken-Doll
Category: Danny Phantom
Language: English, Rated: T
Genres: Sci-Fi/Friendship
Pairing: Clockwork & Jazz F.
Chapters: 3, Words: 5,460, Reviews: 0 Updated: 12-1-09 Published: 11-29-09
Status: In-Progress

Chaos is uncontrollable. It never be controlled nor will it follow rules. Without chaos, there will be no order in the universe s . But somehow, Chaos is now chained down in a female human body. Jazz comes along and a friendship is born.D/S, T/V, J/CW

Time Limit

2009-12-01T18:40:03-08:00

Author: IrisPhantom
Category: Danny Phantom
Language: English, Rated: M
Genres: Drama/Adventure
Pairing: Danny F. & Clockwork
Chapters: 2, Words: 1,836, Reviews: 1 Updated: 12-1-09 Published: 10-13-09
Status: In-Progress

It was a normal day, everything was perfect. Then Desiree decided to grant an accidental wish for our 14 year old hero. Now he has no parents, great, just great, how is he going to fix this one?

Phantom Phans

2009-12-01T17:38:13-08:00

Author: deadlydaisy8o8
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/General
Pairing: Danny F.
Chapters: 1, Words: 1,876, Reviews: 8 Published: 12-1-09
Status: In-Progress

Danny Phantom is dragged into aperaing at a comic book convention much to his displeasure. What kind of truoble will his crazed fans get him into? not to mention his partents who fully intend to take advantage of the situation? and why is skulker there?

Toast

2009-12-01T16:51:01-08:00

Author: Cordria
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/General
Chapters: 10, Words: 13,251, Reviews: 149 Updated: 12-1-09 Published: 8-23-09
Status: In-Progress

Everything that can go wrong, will go wrong. Even if it's just the toast falling butter-side down.

Rise of the Ghost King

2009-12-01T15:59:29-08:00

Author: mon-ra
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Pairing: Danny F.
Chapters: 1, Words: 805, Reviews: 2 Published: 12-1-09
Status: In-Progress

Danny is named hero after the events of PP. However his actions were part of an evil prophecy that could spell doom for both the human world and the ghost zone.

Poetry for a Phantom

2009-12-01T12:39:11-08:00

Author: bluegoo2
Category: Danny Phantom
Language: English, Rated: K+
Genres: Poetry
Chapters: 3, Words: 1,712, Reviews: 0 Updated: 12-1-09 Published: 11-14-09
Status: In-Progress

Poetry is many things. It can be romantic, joyful, sorrowful, or even hurtful. All of these poems will be about Danny Phantom.

100 DP Drabbles

2009-12-01T12:38:57-08:00

Author: Phantom Misfit
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Romance
Pairing: Danny F. & Sam M.
Chapters: 5, Words: 2,852, Reviews: 21 Updated: 12-1-09 Published: 11-28-09
Status: In-Progress

The 100 drabble challenge for Danny Phantom. Has romance, humor, angst, and more! DxS

Danny Phantom: Fresh Start

2009-12-01T11:19:39-08:00

Author: Maetch
Category: Danny Phantom
Language: English, Rated: K+
Genres: General/Humor
Pairing: Danny F.
Chapters: 7, Words: 15,349, Reviews: 36 Updated: 12-1-09 Published: 6-19-07
Status: Complete

In the wake of the Disasteroid Incident, Danny finds out that the fame of being a celebrity is not what he wanted in life. And with new revelations concerning his heroic actions, it may be more of a risk than it's worth.

Silver Bells

2009-12-01T10:20:07-08:00

Author: Rin Flowers
Category: Danny Phantom
Language: English, Rated: T
Genres: Humor/Friendship
Pairing: Dash B. & Danny F.
Chapters: 2, Words: 10,567, Reviews: 11 Updated: 12-1-09 Published: 1-6-08
Status: In-Progress

Danny Fenton, Casper High's very own scrooge, is placed in charge of the secret Santa gifts until Friday. What fun. Bad news to Dash Baxter, who's eager to see what he got, and from whom. twoshot

Whoa, dude!

2009-12-01T04:02:09-08:00

Author: Mischievia SamanthaFenton
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/Romance
Pairing: Danny F.
Chapters: 12, Words: 15,716, Reviews: 35 Updated: 12-1-09 Published: 9-15-09
Status: In-Progress

A new girl shows up, and Danny might have a bit of a crush. Tucker's implying doesn't help much and who knows what Sam thinks? This isn't DxS DON'T HURT MEH!

Amity Idol

2009-11-30T23:53:10-08:00

Author: Insane Guy of DOOM
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/Parody
Pairing: Danny F.
Chapters: 1, Words: 645, Reviews: 3 Published: 11-30-09
Status: In-Progress

Watch Amity Idol, Amity Park's greatest American Idol Ripoff-err Signing contest ever, featuring all your favorite Danny Phantom characters! Who will win, YOU DECIDE! Minor DXS at the begging and end.

Phantom Promise

2009-11-30T21:20:57-08:00

Author: Karen Kano
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Adventure
Pairing: Danny F. & Sam M.
Chapters: 27, Words: 24,068, Reviews: 241 Updated: 11-30-09 Published: 4-8-07
Status: In-Progress

Sam Manson is the daughter to a high class family. Losing her best friend, after he went missing at the age of six. She changed and forgot about a childish promise. 6 years later, she meets a boy with white hair, and green eyes. AU DxS

Serena's Trap

2009-11-30T19:56:46-08:00

Author: Kirby77DP77
Category: Danny Phantom
Language: English, Rated: K+
Genres: Adventure/General
Pairing: Danny F. & Vlad M.
Chapters: 12, Words: 11,485, Reviews: 26 Updated: 11-30-09 Published: 3-23-09
Status: In-Progress

When a strange ghost sends Vlad and Danny into Danny's mind, things don't turn out well.... And now that he's trapped by his own evil Danny has to make some very difficult choices to survive. D/S

Danielle Fenton

2009-11-30T17:37:32-08:00

Author: MadienOfTheMoonlight17
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/Hurt/Comfort
Pairing: Dani & Danny F.
Chapters: 12, Words: 17,698, Reviews: 51 Updated: 11-30-09 Published: 4-9-09
Status: In-Progress

After 2 years in Walker's jail, Danielle is brought home by Danny and was made part of the family. Now, follow Dani has she to learns how to live as a normal kid, and a halfa in a new world.

Fanning the flames

2009-11-30T14:28:15-08:00

Author: Lovealanche4427
Category: Danny Phantom
Language: English, Rated: K+
Genres: Friendship/Romance
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 138, Reviews: 1 Published: 11-30-09
Status: Complete

This is a poem inspired by danny phantom episode "fanning the flames". it is about danny and sam's relationship and partly my relationship with a friend. it is in sam's point of view. i do not own Danny Phantom.

What Did You Do?

2009-11-30T13:53:28-08:00

Author: Surina Fenton x
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/General
Pairing: Vlad M.
Chapters: 1, Words: 427, Reviews: 1 Published: 11-30-09
Status: In-Progress

The First Part Of My New Series! When Surina Ends Up Stuck On A Trip With Her Family Something Happens! What Has Vlad Done And Will Jin Ever Cheer Up x

Your Past Never Leaves You

2009-11-30T06:05:25-08:00

Author: I-am-who-I-am. Get-over-it.
Category: Danny Phantom
Language: English, Rated: T
Genres: Mystery/Horror
Chapters: 4, Words: 4,701, Reviews: 6 Updated: 11-30-09 Published: 11-11-09
Status: In-Progress

Sequel to Lonely But Not Alone. Ryan thinks she is seing things, but is she? And what is this about a haunting past? Will she be able to save herself and her twin before it is too late? And is there a new guy in Ryan's life?

Silver TimeKeeper

2009-11-30T05:18:32-08:00

Author: TimeGhost823
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Adventure
Chapters: 3, Words: 2,423, Reviews: 4 Updated: 11-30-09 Published: 11-8-09
Status: In-Progress

Future fic.Danny is all grown up and married to Sam and have three kids. This is Renne's and Silvers, the middle child's, story and no that is not a typo you just have to read it to find out what it means. Rated for paranoia and swearing.DxS, Txv, CWxO.C.

Give me a chance

2009-11-30T03:19:44-08:00

Author: -MuxicPhantom24-
Category: Danny Phantom
Language: English, Rated: K
Genres: Romance/Hurt/Comfort
Pairing: Danny F. & Sam M.
Chapters: 3, Words: 7,346, Reviews: 9 Updated: 11-30-09 Published: 8-30-09
Status: In-Progress

Valerie wanted Danny back; she was willing to give up ghost hunting. She repented everything she did on the day she broke up with Danny. But it was impossible. Danny liked someone else now, Sam. Vlad found out; And he has some plans. DxS pairings.

Epidemic

2009-11-29T18:19:41-08:00

Author: zizzy333
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Suspense
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 1,796, Reviews: 5 Published: 11-29-09
Status: In-Progress

How can you fight what you can’t see?

Oh Gosh No! Not Another Oh Gosh No Story!

2009-11-29T17:52:34-08:00

Author: Insane Guy of DOOM
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/Parody
Pairing: Danny F. & Sam M.
Chapters: 8, Words: 7,605, Reviews: 37 Updated: 11-29-09 Published: 12-10-08
Status: In-Progress

Now I'm parodying everything! After a run in with some AXE body spray, Danny ends up getting Sam pregnant. And on top of that, there's a new ghost girl in town by the name of Sue Mary. Chocked with spoofs, DXS, and some Lemon Demons songs too!

Daddy, I Mean Danny

2009-11-29T17:46:09-08:00

Author: Willowed Moon
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/General
Pairing: Danny F. & Dani
Chapters: 1, Words: 3,867, Reviews: 6 Published: 11-29-09
Status: Complete

one-shot warning:may get hit by flying fluff majorly Fluffy Dani/Danny bonding fic Dani wants a family that actually loves her, and Dannys name pops up, so off to Amity she goes some DXS rated T cause of a few cuss words, and really slight suggestion

Yin and Yang

2009-11-29T17:43:43-08:00

Author: Yamino Tenshi 202
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Angst
Pairing: Danny F.
Chapters: 5, Words: 17,617, Reviews: 6 Updated: 11-29-09 Published: 5-10-09
Status: In-Progress

Dark looked over at his Danny, who said with enthusiasm, "Who knows what kind of awesome super cool things could be on the other side of that portal." DP series from before it started to the end. AUish Dannyx? Samx? Tuckerx? Rated for later events.

Tamashii no Me

2009-11-29T17:28:36-08:00

Author: Teira Runes-Klein
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Angst
Pairing: Danny F.
Chapters: 11, Words: 22,254, Reviews: 8 Updated: 11-29-09 Published: 7-30-09
Status: In-Progress

Humans are preyed upon...Ghosts refuse to enter their domain...Wisdom fall...Trust to betrayal...Love to lust..Is this what the legend meant? Our final days are upon us? Then let our savior awaken from his slumber and bring our sinful world to the light.

Ultimate Phantom

2009-11-29T17:05:55-08:00

Author: Jiece18
Category: Danny Phantom
Language: English, Rated: K+
Genres: Adventure/Supernatural
Pairing: Danny F.
Chapters: 13, Words: 18,258, Reviews: 15 Updated: 11-29-09 Published: 5-13-07
Status: In-Progress

A redone version of The Danny Phantom series.

The Clueless Gene

2009-11-29T16:55:45-08:00

Author: TheFifthCharmedOne
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Friendship
Pairing: Danny F. & Sam M.
Chapters: 5, Words: 4,414, Reviews: 6 Updated: 11-29-09 Published: 11-25-09
Status: In-Progress

Next generation, Danny Fenton Jr. has a best friend named Alex, who just happens to have a huge crush on him? Is chaos sure to ensue? Yeah, probably. T cause I felt like it.

Back To Camp Skull and Crossbones

2009-11-29T16:55:30-08:00

Author: I'm-paranormal33
Category: Danny Phantom
Language: English, Rated: T
Genres: Humor/Drama
Pairing: Sam M.
Chapters: 1, Words: 1,538, Reviews: 1 Published: 11-29-09
Status: In-Progress

Danny and Sam's class goes back to Camp Skull and Crossbones. But Danny's not the only ghost there. There's another ghost haunting the area and protective of Sam. review

Chatting to Chat

2009-11-29T16:50:04-08:00

Author: PhantomInvader
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Humor
Pairing: Danny F.
Chapters: 5, Words: 2,312, Reviews: 49 Updated: 11-29-09 Published: 5-2-09
Status: In-Progress

Because superhero teenagers are still teenagers, and therefore they know how to use a computer and log into a school-based chatroom. Disgraceful yet humorous, a stress relief fic for Phanny's...stress. Rated for possible swearing in future chapters.

Unexpected Abuse

2009-11-29T16:00:25-08:00

Author: Nimrod The Writer
Category: Danny Phantom
Language: English, Rated: K+
Genres: Hurt/Comfort/General
Pairing: Danny F. & Jack F.
Chapters: 12, Words: 38,766, Reviews: 85 Updated: 11-29-09 Published: 4-6-09
Status: In-Progress

Danny's home life turns worse for the wear when Maddie goes off to Germany to train aspiring ghost hunters. If you think Vlad is crazy-obsessive without Maddie, wait until you see Jack.

A Heartache No One Can Heal

2009-11-29T14:21:38-08:00

Author: Crazy4Pie
Category: Danny Phantom
Language: English, Rated: T
Genres: Hurt/Comfort/Family
Pairing: Danny F. & Vlad M.
Chapters: 5, Words: 9,391, Reviews: 28 Updated: 11-29-09 Published: 4-28-09
Status: Complete

ON PERMANENT HIATUS. PLEASE DO NOT ADD THIS STORY TO YOUR ALERTS LIST BECAUSE IT IS NO LONGER UPDATING. THANK YOU.

The Colorless Sky

2009-11-29T14:05:45-08:00

Author: Nylah
Category: Danny Phantom
Language: English, Rated: T
Genres: Angst/Tragedy
Pairing: Danny F.
Chapters: 16, Words: 43,273, Reviews: 48 Updated: 11-29-09 Published: 10-1-08
Status: In-Progress

Trapped in a collapsed tunnel, buried under tons of rock and with little hope of survival, there is really not much else to do but talk and look back on how he ended up there. In the end, only a desperate act may save him... but at what cost?

Spectra Challenge

2009-11-29T12:55:55-08:00

Author: Phantom Voltage
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F. & P. Spectra
Chapters: 1, Words: 46, Reviews: 0 Published: 11-29-09
Status: In-Progress

A pairing Challenge

Kitty Challenge

2009-11-29T12:53:49-08:00

Author: Phantom Voltage
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/General
Pairing: Danny F. & Kitty
Chapters: 1, Words: 46, Reviews: 1 Published: 11-29-09
Status: Complete

A Kitty and Danny Fenton Pairing

Memory Alterations

2009-11-29T12:45:52-08:00

Author: Ravne13
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 7, Words: 8,040, Reviews: 0 Published: 11-29-09
Status: In-Progress

Kat Evans has moved to Amity Park and discovers the identity of the infamous ghost boy Danny Phantom. set before the Crack Story by TavalyaRa on Disclaimer: I do NOT own Danny Phantom no matter how much I wish I did...

Send me a Song

2009-11-29T11:03:09-08:00

Author: Rin Flowers
Category: Danny Phantom
Language: English, Rated: M
Genres: General
Pairing: Danny F. & Dash B.
Chapters: 6, Words: 5,768, Reviews: 21 Updated: 11-29-09 Published: 6-5-09
Status: In-Progress

Nursery rhymes and lullabys can inspire just as much as a playlist. Answer to a Challenge, collection of shorts, contains slash of varying ratings so tread carefully. Changed the title.

The Mutation

2009-11-29T10:58:53-08:00

Author: QueenSkellington
Category: Danny Phantom
Language: English, Rated: K+
Genres: Drama/Supernatural
Pairing: Danny F. & Vlad M.
Chapters: 5, Words: 7,454, Reviews: 30 Updated: 11-29-09 Published: 10-13-09
Status: In-Progress

Danny is already, pretty messed up. Well one day he runs into a new ghost enemy, Gemini. He turns Danny into a mix between Danny Phantom and Danny Fenton. How will our hero brave through this? *Parents don't know Danny's secret yet*

Clandestine

2009-11-29T00:26:33-08:00

Author: eternitylover09
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Drama
Chapters: 2, Words: 866, Reviews: 1 Updated: 11-29-09 Published: 11-28-09
Status: In-Progress

Her 3 year old daughter was dying of leukemia, what other option could she choose? Work for Vlad Masters or just let her daughter die without the chemotherapy? She would do anything. Even turn her dauginto a halfa. Contains OCs.First fic, be nice!

Bitter Dreams

2009-11-28T21:54:57-08:00

Author: soulful100
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F. & Dani
Chapters: 2, Words: 2,141, Reviews: 7 Updated: 11-28-09 Published: 11-25-09
Status: In-Progress

Sequel to 'Helping Danielle'. Somebody or something has been trying to tell Danny something in his dreams. But what? And who are they? Rated T cause I'm paranoid.

The Phantom Retribution

2009-11-28T20:55:44-08:00

Author: fffan231
Category: Danny Phantom
Language: English, Rated: K+
Genres: Romance/Supernatural
Chapters: 4, Words: 24,503, Reviews: 7 Updated: 11-28-09 Published: 10-17-08
Status: In-Progress

Sequel to Keep Holding On. We all have to face our future. It is an inevitable path we must walk down in the journey of our lives. But what do you do when your future comes back to haunt you? Danny Sam DxS Dan Phantom

Our Daughter from the Future

2009-11-28T20:30:14-08:00

Author: Mystique97
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/Romance
Pairing: Danny F. & Sam M.
Chapters: 6, Words: 10,263, Reviews: 13 Updated: 11-28-09 Published: 11-15-09
Status: In-Progress

I know, I know. Title sucks. Anyways, Danny and Sam take care of their 12 years old daughter from the future while she is trying to dodge a certain enemy. R&R

Danny Phantom and the Angel Princess

2009-11-28T20:22:13-08:00

Author: Edlover23
Category: Danny Phantom
Language: English, Rated: K
Genres: Romance/Friendship
Pairing: Danny F.
Chapters: 5, Words: 5,627, Reviews: 0 Updated: 11-28-09 Published: 11-20-09
Status: In-Progress

What if angel left the earh for good and there where no more what would happen to the world would it fall into darkness or is there a angel that can save the world?

Coming Back

2009-11-28T19:15:13-08:00

Author: sappyhalmarkgreetingsaremylife
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Sci-Fi
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 603, Reviews: 2 Published: 11-28-09
Status: In-Progress

After Danny left, lost in the ghost zone, Sam and Tucker never lost hope. So when he comes back after about 2 years, how much has he changed? Is he still the real Danny or someone completely different? Or could he be someone Sam may like even more?

City Life

2009-11-28T16:38:49-08:00

Author: Nimrod The Writer
Category: Danny Phantom
Language: English, Rated: M
Genres: General/Romance
Pairing: Danny F. & Vlad M.
Chapters: 4, Words: 17,629, Reviews: 18 Updated: 11-28-09 Published: 11-23-09
Status: Complete

Danny's been away to college for a while now. So what's a billionaire to do when he comes across an old scrapbook and suddenly finds himself faced with the urge to go see him? Well he packs up his suitcase and heads to New York, of course. Pompous Pep.

The Chosen One

2009-11-28T15:40:17-08:00

Author: LMV2003
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Romance
Chapters: 3, Words: 13,982, Reviews: 13 Updated: 11-28-09 Published: 11-23-09
Status: In-Progress

Danny finds out that he's adopted, and his real parents are ghost Keepers of Life. They find him through a mark meaning something, but what? And there is another secret about Danny? But what? Better than it sounds. Some DXS and OcXOcs, maybe blood.

Yay! This Made My Day!

2009-11-28T14:57:01-08:00

Author: Surina Fenton x
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 1, Words: 955, Reviews: 2 Published: 11-28-09
Status: In-Progress

This Is A Little Story By My Best Buddy Jin! Thanks Jinny!

This Will Only Hurt Alot

2009-11-28T13:47:15-08:00

Author: XX-ThEwOrLdNeEdSaChAnGe-XX
Category: Danny Phantom
Language: English, Rated: T
Genres: Hurt/Comfort/Romance
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 1,864, Reviews: 6 Published: 11-28-09
Status: In-Progress

You can scream, No one will hear you. You can cry, no one will care. If you die, no one will be here to cry for you. Because your ALONE." What if Danny was evil, Tucker was his sidekick, and Sam his oh-so-mesmerising prisoner? Rating may change. plsz r r

Growing Up

2009-11-28T13:32:03-08:00

Author: Shadow1248
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/General
Pairing: Vlad M. & Clockwork
Chapters: 23, Words: 46,401, Reviews: 30 Updated: 11-28-09 Published: 1-3-09
Status: In-Progress

The Fenton Thermos had never been meant for the permanent holding of ghosts; and with Dan’s cell weakening, Clockwork needs to set the stage. Too bad he’s missing one of his main actors.

Catalyst

2009-11-28T09:09:42-08:00

Author: DanPhantomCrush
Category: Danny Phantom
Language: English, Rated: T
Genres: Mystery/Drama
Pairing: Danny F. & Sam M.
Chapters: 30, Words: 197,553, Reviews: 360 Updated: 11-28-09 Published: 5-10-06
Status: In-Progress

Who is Clockwork? A friend to Danny, or a master manipulator? Sam makes a drastic sacrifice to preserve Danny's world but ultimately only puts off the inevitable. And no one escapes unchanged; her family, Danny's family, even Vlad. Post TUE.

RAYEARTH KNIGHTS: DANNY THE TSUNAMI

2009-11-28T07:22:49-08:00

Author: hypn0s
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Fantasy
Pairing: Danny F.
Chapters: 10, Words: 119,070, Reviews: 45 Updated: 11-28-09 Published: 5-24-09
Status: In-Progress

A tale, a myth trasending the bonds of time and space, speak of three Knights with untold power, bound to the elements, this is the story of one of them,like a tidal wave all oposing him will be washed away, this is Danny, this is his story...

Stand Out DP

2009-11-27T23:25:54-08:00

Author: superpowerfreak95
Category: Danny Phantom
Language: English, Rated: K+
Genres: General/Romance
Pairing: Danny F.
Chapters: 1, Words: 935, Reviews: 2 Published: 11-27-09
Status: Complete

When Danny wants to woo and girl, he really can woo a girl. All he needs is the right song.

The Hunt of the Halfa

2009-11-27T22:03:47-08:00

Author: Dannyandsamlover
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Suspense
Pairing: Danny F.
Chapters: 7, Words: 11,108, Reviews: 15 Updated: 11-27-09 Published: 7-14-09
Status: In-Progress

The mutants are being imprisoned and destroyed by mutant hunters. Danny realizes that the pain and agony of the mutants have gotten worse and it is now his job to bring justice. But if he does this, he must chose to go against his parents. Danny's POV

Danny Phantom in A Trip Through Time

2009-11-27T22:03:41-08:00

Author: TrojanHalks2012
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Suspense
Pairing: Danny F. & Vlad M.
Chapters: 8, Words: 43,739, Reviews: 14 Updated: 11-27-09 Published: 10-2-09
Status: In-Progress

Shortly after arriving back home, Team Phantom was ambushed by Vlad and his gang. But now that our heroes are home, can they figure out why everything is all wrong and defeat him and their evil alter-ego clones before Plasmius takes control of the planet?

Different Dimensions

2009-11-27T20:46:39-08:00

Author: comando
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/General
Pairing: Dani & Danny F.
Chapters: 3, Words: 1,956, Reviews: 1 Updated: 11-27-09 Published: 11-13-09
Status: In-Progress

there are many Dimensions in the world, ones where individuals took different stpes, ones that are very different, but very simmilar to our own. AU

Vlad's autumn

2009-11-27T19:12:37-08:00

Author: Mastermindhunter
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Drama
Pairing: Vlad M. & Danny F.
Chapters: 9, Words: 16,995, Reviews: 6 Updated: 11-27-09 Published: 10-8-09
Status: In-Progress

Autumn is now here. But Vlad decides to stay the whole fall season down at the Fentons. Somethings different though. Vlad just isn't Vlad right now! Warning Yaoi

Ghost Files

2009-11-27T18:37:06-08:00

Author: bluegoo2
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Chapters: 5, Words: 1,001, Reviews: 13 Updated: 11-27-09 Published: 11-5-09
Status: In-Progress

Did you ever wonder about the ghost files on Danny's computer?

Danny Phantom Bloopers

2009-11-27T17:23:35-08:00

Author: truephan
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/Parody
Chapters: 12, Words: 8,418, Reviews: 31 Updated: 11-27-09 Published: 11-6-09
Status: In-Progress

ORIGINALLY WRITTEN BY NICKTENDO SQUAD. Now adopted by truephan. Original Summary: Bloopers of the show I made up, give me ideas for more of them... details inside... PLEASE R&R AND REVIEW! AND NO FLAMING!

Fate Under Moonlight

2009-11-27T17:02:29-08:00

Author: Cap. Dead Beard
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/General
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 1,174, Reviews: 2 Published: 11-27-09
Status: Complete

Danny Sam under Moonlight,plus his parents over hear his secert love for her.

Mystical Love

2009-11-27T16:43:34-08:00

Author: DramaQueen95
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Adventure
Pairing: Danny F. & Sam M.
Chapters: 17, Words: 22,237, Reviews: 121 Updated: 11-27-09 Published: 12-7-08
Status: In-Progress

Seconds later, a new ghost emerged from the alley.She had long auburn hair and wore a red leather tube top and pants.She had a red sash around her neck and she wore a red bandanna on her head.Her red-gold eyes glistened.The ghost looked around.Sam/Danny

Day in the Life, A

2009-11-27T15:10:56-08:00

Author: Quacked Lurker
Category: Danny Phantom
Language: English, Rated: K
Genres: General/Family
Pairing: Dani
Chapters: 2, Words: 3,002, Reviews: 3 Updated: 11-27-09 Published: 3-27-09
Status: Complete

Was a ONESHOT. Its not all fun and games after Phantom Planet. Now, see a holiday scene that can occur any time after season 2. Have a wonderful Thanksgiving.

How of the halfa

2009-11-27T12:22:24-08:00

Author: pegasusVladdy
Category: Danny Phantom
Language: English, Rated: K
Genres: Mystery/Humor
Pairing: Vlad M.
Chapters: 21, Words: 15,198, Reviews: 4 Updated: 11-27-09 Published: 9-21-09
Status: Complete

A girl who's mysterious comes to live with the Fentons for a while Danny thinks there's something odd about her and Vlad comes to vist but he's after a mysterious ghost.

Phantom Encore

2009-11-27T12:05:21-08:00

Author: superpowerfreak95
Category: Danny Phantom
Language: English, Rated: K+
Genres: General/Parody
Pairing: Danny F. & Tucker F.
Chapters: 1, Words: 1,556, Reviews: 2 Published: 11-27-09
Status: Complete

What happens when you mix a ghost boy, techno geek, and rap song together? You get this. It's pretty clean and for DP and LP fans.

Simple Physics

2009-11-27T11:37:12-08:00

Author: AnihyrMoonstar
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/General
Pairing: Tucker F. & Dash B.
Chapters: 1, Words: 1,828, Reviews: 6 Published: 11-27-09
Status: In-Progress

“Friction—the rubbing together of two objects, or the effort expended in moving one object over another with pressure,” said Tucker. Dash considered this. “So friction is like…sex?” Dash/Tucker

26 Priceless Moments

2009-11-27T10:24:24-08:00

Author: PhantomWolfe
Category: Danny Phantom
Language: English, Rated: T
Genres: Friendship/Romance
Pairing: Sam M. & Danny F.
Chapters: 1, Words: 3,958, Reviews: 6 Published: 11-27-09
Status: In-Progress

Just random fluff. See Authors Notes inside. Rated T for safety. Alternate Universe. Danny and Sam. UPDATED. On Hiatus.

Stronger Than That

2009-11-27T10:19:08-08:00

Author: Tech-Man
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Romance
Pairing: Danny F. & Sam M.
Chapters: 6, Words: 11,426, Reviews: 31 Updated: 11-27-09 Published: 8-31-09
Status: In-Progress

Danny has been seriously injured in a battle with Skulker and turned up in a comma; Sam and Tucker have gone in search of the secret behind Skulker’s latest upgrade. Danny meets a new ghost, and Sam must confront her feelings about Danny. D&S

Nothing's Forever

2009-11-27T00:17:03-08:00

Author: JamesPotter-SiriusBlack
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Humor
Pairing: Danny F. & Sam M.
Chapters: 3, Words: 3,339, Reviews: 5 Updated: 11-27-09 Published: 8-13-09
Status: In-Progress

Danny and Sam are dating. Sam is pregnant. But is the baby Danny's? Phantom Planet never happened, we're ignoring it, They're 15/sophomores. DannyXSam, TuckerXValerie, TuckerXOC. Previously "James Sucks at titles, so this is it"

Disorderly Conduct

2009-11-26T20:00:19-08:00

Author: x0xPuppyLuhve
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Friendship
Pairing: Danny F.
Chapters: 1, Words: 1,732, Reviews: 1 Published: 11-26-09
Status: In-Progress

Danny is only slightly surprised when his life becomes a bit more complicated than usual. As he struggles to keep his secret from being revealed, another distraction from a familar foe comes into the picture. SLOW UPDATING. Contains OC. Pairings Unknown.

Not With The Enemy

2009-11-26T15:02:33-08:00

Author: CrackPairingAddict
Category: Danny Phantom
Language: English, Rated: K
Genres: Family/Crime
Pairing: Danny F.
Chapters: 1, Words: 706, Reviews: 2 Published: 11-26-09
Status: In-Progress

A trip to the hospital leads to disaster for the Fentons. Can they survive this obstable, or will their family fall apart?

Valdrucles

2009-11-26T13:00:28-08:00

Author: Shadow Moss
Category: Danny Phantom
Language: English, Rated: K+
Genres: Adventure/Mystery
Pairing: Valerie G. & Danny F.
Chapters: 8, Words: 13,401, Reviews: 13 Updated: 11-26-09 Published: 8-27-09
Status: In-Progress

Lost and alone in a forest, Valerie helps an injured wolf. In return, the wolf saves Valerie's life. But what will happen with Valerie's mission to hunt Danny Fenton's ghost? Will she find out the truth about Fenton? Or about a mysterious new friend? AU

Paranoia

2009-11-26T10:49:10-08:00

Author: Adi Black
Category: Danny Phantom
Language: English, Rated: M
Genres: Angst/General
Pairing: Dan Phantom & Danny F.
Chapters: 3, Words: 10,701, Reviews: 6 Updated: 11-26-09 Published: 11-5-09
Status: In-Progress

Danny wakes up to find himself trapped by his older evil self after which 'things' happen. Even after being released Danny soon realizes that he can never truly be 'free' again. DanxDanny prominent slash

Straight Answers

2009-11-26T02:32:45-08:00

Author: NINJA-RENKA
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Romance
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 6,641, Reviews: 2 Published: 11-26-09
Status: Complete

-Sequel to "Hard To Say"- November has rolled around and Danny wants to have one more honest conversation with his ghostly counterpart. Though the teen may be getting himself into more than he originally thought. DANNY/VLAD -PART THREE OF THREE-

Jackie Phantom

2009-11-26T00:25:26-08:00

Author: Nano Phantom
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Friendship
Chapters: 5, Words: 9,698, Reviews: 7 Updated: 11-26-09 Published: 11-1-09
Status: In-Progress

I am not just another character that fan fiction writers add to the Danny Phantom series, for I am more than that. I am a person, a ghost, your hero, and your friend. Nano's NaNoWriMo 2009.

Burdens

2009-11-25T23:02:37-08:00

Author: bloodmoon13
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 10, Words: 48,074, Reviews: 80 Updated: 11-25-09 Published: 3-17-07
Status: In-Progress

Thanks to Desiree Danny and his class are stuck in some creepy place where they have to literally carry their burdens on their backs someone decides to cheat what they find out will surprise them.

Guilt, Betrayal, and Ascension

2009-11-25T18:44:47-08:00

Author: MetaliHead2x4
Category: Danny Phantom
Language: English, Rated: K+
Genres: Supernatural/Hurt/Comfort
Pairing: Dan Phantom
Chapters: 4, Words: 6,032, Reviews: 2 Updated: 11-25-09 Published: 11-2-09
Status: In-Progress

Everything Danny loves is in ashes as a swirl of emotions appear to torment him. Backstory on Dark Danny, will contain a few OC's later later later in the story. As true to the series and the timeline as I could make it. K for mild mentions of death.

Gender Confusion The Docterine Danny

2009-11-25T18:42:01-08:00

Author: Elena Forest
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Humor
Pairing: Danny F. & Sam M.
Chapters: 12, Words: 55,311, Reviews: 33 Updated: 11-25-09 Published: 10-3-09
Status: In-Progress

ADOPTED FROM WINGSOFMORPHIUS Danny's life is confusing enough with ghostly battles and searching for his parents, not to mention butting horns with Vlad. But with a new roomate in the mix...

Gender Confusion The Saga of Sam

2009-11-25T18:41:32-08:00

Author: Elena Forest
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Humor
Pairing: Sam M. & Danny F.
Chapters: 12, Words: 50,985, Reviews: 63 Updated: 11-25-09 Published: 10-3-09
Status: In-Progress

ADOPTED FROM WININGSOFMORPHIUS Sick of her parents, Samantha Manson takes refuge at an all boy's school. No one would think of looking for her there! But what happens when her roomate's a hottie with a big seceret of his own...?

Hidden Secrets

2009-11-25T18:25:51-08:00

Author: Linzerj loves Warriors
Category: Danny Phantom
Language: English, Rated: K+
Genres: Friendship/Family
Pairing: Danny F. & Vortex
Chapters: 1, Words: 1,432, Reviews: 4 Published: 11-25-09
Status: In-Progress

Valerie finds Danny's journal. Then Danny's parents capture Phantom, and...well...it's complicated to explain. I made this out of pure boredom, so read, please, but, if you don't wanna...ah well, I tried.

Real Life

2009-11-25T17:43:42-08:00

Author: Cordria
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Friendship
Pairing: Danny F. & Sam M.
Chapters: 17, Words: 109,122, Reviews: 568 Updated: 11-25-09 Published: 9-17-07
Status: In-Progress

And what if it WAS real?

Thankful

2009-11-25T16:16:57-08:00

Author: Phantom Misfit
Category: Danny Phantom
Language: English, Rated: K+
Genres: Friendship/Hurt/Comfort
Pairing: Danny F.
Chapters: 1, Words: 742, Reviews: 3 Published: 11-25-09
Status: Complete

Danny is feeling worthless on Thanksgiving, but can his friends and family change that?

His and Hers

2009-11-25T13:52:48-08:00

Author: MyAibou
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance
Pairing: Danny F. & Sam M.
Chapters: 24, Words: 84,491, Reviews: 152 Updated: 11-25-09 Published: 11-20-08
Status: In-Progress

A series of oneshots, or oneshot pairs. Introspection from Danny's, then Sam's, perspective at various points in their relationship. Fluff. DxS.

Stay Alive

2009-11-25T12:18:46-08:00

Author: DjSammey33
Category: Danny Phantom
Language: English, Rated: T
Genres: Horror/Drama
Pairing: Danny F. & Star
Chapters: 6, Words: 10,137, Reviews: 12 Updated: 11-25-09 Published: 2-7-09
Status: Complete

Danny and friends come across a new video game called 'Stay Alive', but what happens when they start dying off one by one, the way they died in the game?

A Knock at the Door

2009-11-25T09:56:27-08:00

Author: DrendeSalkash
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F. & Sam M.
Chapters: 10, Words: 11,288, Reviews: 23 Updated: 11-25-09 Published: 8-13-09
Status: In-Progress

After a long day's work Danny hears an incessant knocking at the door. when he sees them run away he chases, only to find out it's.....find out by reading

Mastermind

2009-11-25T00:28:26-08:00

Author: CrackPairingAddict
Category: Danny Phantom
Language: English, Rated: K+
Genres: Tragedy/Hurt/Comfort
Pairing: Vlad M. & Maddie F.
Chapters: 5, Words: 5,132, Reviews: 10 Updated: 11-25-09 Published: 9-27-09
Status: In-Progress

Calmly, Vlad turned to her with a small, sad smile that refused to reach his eyes. "I can't tell a lie Maddie," he murmured, his smile unwavering. ..."Yes. Yes I am Plasmius." V/M. Mild Language. Note: I do not own Danny Phantom: Butch Hartman does.

Like A Bat Outta Hell

2009-11-24T16:57:48-08:00

Author: TacticianZephine
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Tragedy
Pairing: Ember
Chapters: 1, Words: 3,410, Reviews: 1 Published: 11-24-09
Status: Complete

Resubmitted due to error. She was just like any other girl her age, right? Rated for language.

Stranger Allies

2009-11-24T12:21:11-08:00

Author: Great Gray Owl
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 8, Words: 13,737, Reviews: 21 Updated: 11-24-09 Published: 10-14-09
Status: In-Progress

Clockwork's methods of keeping Danny alive, and content, are sometimes questionable at best. But Danny has never had a reason to think that his ghostly guardian wasn't trying to keep him safe, and if not completely happy, at least mostly sane...Until now.

Motnahp's Oneshots

2009-11-24T05:29:51-08:00

Author: motnahp-724
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 19, Words: 20,364, Reviews: 59 Updated: 11-24-09 Published: 8-26-09
Status: In-Progress

A collection of oneshots, with varying genres, pairings, and ratings. Full summaries inside. Canon, fanon, incest, slash, chances are you’ll find it here. Most are T or lower, chapters 5, 16, and 27 are M.

Halfa Life

2009-11-23T20:39:53-08:00

Author: Dream Trance
Category: Danny Phantom
Language: English, Rated: T
Genres: Friendship/Family
Pairing: Danny F. & Dan Phantom
Chapters: 18, Words: 108,840, Reviews: 147 Updated: 11-23-09 Published: 4-10-09
Status: In-Progress

One human walks into a soon-to-be portal. A flash a light and one half human and one half ghost walk out. Yup. That sounded lame. Anyway, this story focuses on Fenton's and Phantom's friendship. Or lack. You'll see. AU! NOT DFxDP. Just brotherly.

Watched

2009-11-23T17:26:41-08:00

Author: Mz. Jinky
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/General
Pairing: Danny F. & Sam M.
Chapters: 5, Words: 10,033, Reviews: 12 Updated: 11-23-09 Published: 11-2-09
Status: In-Progress

Living with a brother and morning parents are bad enough for Sam Manson. Loving your best friend is bad enough for her. But can her luck get worse? Is Sam being watched? Can Danny save her? Disclaimer: I do not own "Danny Phantom" Or their characters.

The Phantom Squad

2009-11-23T15:35:35-08:00

Author: JetravenEx
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F.
Chapters: 1, Words: 927, Reviews: 1 Published: 11-23-09
Status: In-Progress

A fanfic involving my team the Rayquaza squad! What happens when they get sent down to Amity Park for a vaction and meet up with Danny Phantom? Can they help him avoid the government or will he fall into the clutches of the Guys in white?

The Meaning in Between

2009-11-23T10:54:56-08:00

Author: A Poor Player
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 2, Words: 978, Reviews: 2 Updated: 11-23-09 Published: 11-6-09
Status: In-Progress

A series of one shots based on the idea "less is more." Various genres. Predominately ghost origin stories.

Walking with Strangers

2009-11-23T09:21:15-08:00

Author: Raven Fireheart
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Supernatural
Pairing: Danny F. & Sam M.
Chapters: 2, Words: 4,853, Reviews: 2 Updated: 11-23-09 Published: 11-12-09
Status: In-Progress

Danny was living an already hectic 15 year old boys life now things get even more insain as his entier life gets flipped upside down by a strange ghost named violet what is they secret she is trying to share and what will it take to set things right R&R

Awake and Alive DP

2009-11-23T08:57:39-08:00

Author: superpowerfreak95
Category: Danny Phantom
Language: English, Rated: K
Genres: General/Poetry
Pairing: Danny F.
Chapters: 1, Words: 942, Reviews: 2 Published: 11-23-09
Status: Complete

When the world is bringing our fellow ghostboy down, can a sing help cheer him up? This isn't a good summary so just read inside.

Broken

2009-11-23T08:30:16-08:00

Author: Trevor the Enchanter
Category: Danny Phantom
Language: English, Rated: T
Genres: Angst/Hurt/Comfort
Pairing: Maddie F. & Vlad M.
Chapters: 2, Words: 5,570, Reviews: 8 Updated: 11-23-09 Published: 11-5-09
Status: In-Progress

At the age of 16, Vlad, Maddie, and Jack live semi-normal lives... until someone attacks Maddie Warning: very dark

Prototype

2009-11-23T06:10:26-08:00

Author: Fayrandothneil
Category: Danny Phantom
Language: English, Rated: K
Genres: Angst/Friendship
Chapters: 3, Words: 3,626, Reviews: 7 Updated: 11-23-09 Published: 10-29-09
Status: In-Progress

Vlad Masters had created the perfect weapon, only problem was it was unstable. The GIW ordered it to be terminated, but Vlad had other ideas to save his creation. Now in the hands of his former best friends, the Phantom Project Prototype must learn fast!

Fame and Infamy

2009-11-22T16:43:00-08:00

Author: Hordak's Pupil
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Adventure
Pairing: Danny F.
Chapters: 23, Words: 48,757, Reviews: 130 Updated: 11-22-09 Published: 12-2-08
Status: In-Progress

Was Starlife by Em Phantom. Concerned about Danny, Jack and Maddie send Danny and Jazz to stay with an old friend but things are never so easy for Danny. Post PP. Chapter 21 up. Please R&R.

Ghost's Fall

2009-11-22T16:33:24-08:00

Author: yaoivampire
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Romance
Pairing: Danny F. & Vlad M.
Chapters: 7, Words: 6,784, Reviews: 22 Updated: 11-22-09 Published: 1-27-08
Status: In-Progress

Full summary inside. Pompous pep! or DannyxVlad

Aproximatly 30 min after Danny saves the planet

2009-11-22T16:18:47-08:00

Author: deadlydaisy8o8
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/Friendship
Pairing: Dash B. & Valerie G.
Chapters: 3, Words: 2,495, Reviews: 9 Updated: 11-22-09 Published: 11-20-09
Status: In-Progress

Just some little ideas i had about what would come next after the small group of people at the north pole found out about his secret identity. Kinda fun to think about what would happen. Hope I potrayed everyone the right way. please R&R!

Lost

2009-11-22T14:47:01-08:00

Author: Nylah
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama
Pairing: Danny F.
Chapters: 43, Words: 173,387, Reviews: 418 Updated: 11-22-09 Published: 1-11-08
Status: In-Progress

Danny's friends are missing. Danny's life spins out of control when, in his search for them and himself, he find himself being viewed as a suspect rather than as a victim. With no one but his sister to help him, Danny tries to hold on to his sanity. No PP

The Brother Chronicles

2009-11-22T14:43:00-08:00

Author: Kaye Phantus
Category: Danny Phantom
Language: English, Rated: K+
Genres: Supernatural/Friendship
Chapters: 8, Words: 8,743, Reviews: 12 Updated: 11-22-09 Published: 8-12-09
Status: In-Progress

What would happen if, post-PP, Danny finds out he has two brothers he never knew about, he and they are identical triplets, they died at birth, and are halfas too. Meet Julian and Adam, time-warped by Clockwork, they meet Danny and well... fun happens ;D

Help Me

2009-11-22T13:28:14-08:00

Author: Dannyphantom99
Category: Danny Phantom
Language: English, Rated: T
Genres: Tragedy/General
Pairing: Danny F.
Chapters: 1, Words: 632, Reviews: 1 Published: 11-22-09
Status: In-Progress

After the desateriod, Danny got the girl, and basicly saved the world. But Vlad is back! And what if he knows about...Dark Dan? And he wants to try an experiment on Danny? And what happends if the experament turnes him into..the oppisite Gender?

Past, Present, Future

2009-11-22T13:02:09-08:00

Author: yaoivampire
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 1,320, Reviews: 2 Published: 11-22-09
Status: In-Progress

The real title to this story is Longing for the Past, Hating the Present, Dreading the Future. However, that wouldn't fit. Full summary inside. For right now, I am unsure of the categorization for this story, but as soon as I know, I'll edit the category.

Falling Up:Preface

2009-11-22T10:44:33-08:00

Author: Ash-Specter-chan
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Drama
Pairing: Danny F.
Chapters: 1, Words: 1,206, Reviews: 1 Published: 11-22-09
Status: In-Progress

The beginning of the adventures of a girl put into the chaos of the world she thought was fictional. Read on to find out more in the DP fan fic: Falling Up! Written by deviantart's Savedpgal101.

Letters Unsent

2009-11-22T06:34:12-08:00

Author: candelight
Category: Danny Phantom
Language: English, Rated: K
Genres: Angst/Hurt/Comfort
Pairing: Danny F. & Vlad M.
Chapters: 3, Words: 7,689, Reviews: 11 Updated: 11-22-09 Published: 11-16-09
Status: In-Progress

Based off of Pearl87’s Checkmate. He knows it’s unhealthy. Pointless, as a matter of fact-seeing as they’re always lost in emerald flames or tucked away to burn later. Still, this is how Danny speaks to his loved ones in his own grief-silently.

Another Sam Story

2009-11-22T03:10:05-08:00

Author: Looka'sMagicHell
Category: Danny Phantom
Language: English, Rated: K+
Genres: Romance/Drama
Pairing: Sam M. & Danny F.
Chapters: 1, Words: 7,295, Reviews: 2 Published: 11-22-09
Status: Complete

Who's the mysterious girl did Danny dance with at his school's masked dance? And what does Sam tell him at her stepsister's party? Another Sam story, or Sam's Cinderella. PLEASE REVIEW!

Cirque Berserk

2009-11-21T21:31:57-08:00

Author: .Poisoned Scarlet.
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Drama
Pairing: Sam M. & Danny F.
Chapters: 4, Words: 15,087, Reviews: 37 Updated: 11-21-09 Published: 9-20-09
Status: In-Progress

Non PP Compliant. “How should I scare you?” After 5 years, Circus Gothica revisits Amity Park. Only this time, Freakshow isn't the one in charge...

Helping Danielle

2009-11-21T21:24:26-08:00

Author: soulful100
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F. & Dani
Chapters: 13, Words: 12,455, Reviews: 41 Updated: 11-21-09 Published: 10-24-09
Status: Complete

Danny suddenly finds Danielle bruised and beaten. What happened? No PP. T because I'm paranoid.

King, Queen, and Masters

2009-11-21T12:22:17-08:00

Author: candelight
Category: Danny Phantom
Language: English, Rated: K+
Genres: Drama/Angst
Pairing: Vlad M. & Danny F.
Chapters: 15, Words: 34,325, Reviews: 51 Updated: 11-21-09 Published: 9-20-09
Status: In-Progress

Based on Pearl87’s Checkmate. Whichever side, chess is a battle of wits and deduction. To win, sacrifices must be made. But Vlad must now confront himself: Which piece does he dare risk in this game? Maddie or Danny? And which piece really means the most?

Good Luck Tuck

2009-11-21T10:43:39-08:00

Author: Jammin Jabala
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Humor
Pairing: Tucker F.
Chapters: 2, Words: 5,359, Reviews: 13 Updated: 11-21-09 Published: 11-15-09
Status: In-Progress

After Phantom Planet, Tucker's life has started going dow hill He's beat up every day, he's be striped of his his position as Mayor, and worst of all, he has no girlfreind. But what happens when Tucker's wish for all girls to like him is granted?

Fanning The Flames My Version XOX

2009-11-21T06:32:09-08:00

Author: Surina Fenton x
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance
Pairing: Danny F.
Chapters: 2, Words: 721, Reviews: 6 Published: 11-21-09
Status: In-Progress

My Version Of Fanning The Flames With My OC Danny/Surina

My light promise

2009-11-21T01:01:01-08:00

Author: Heracelio
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/Sci-Fi
Pairing: Dan Phantom & Valerie G.
Chapters: 6, Words: 13,134, Reviews: 1 Updated: 11-21-09 Published: 10-19-09
Status: In-Progress

hello every one this is my first story, In the futur where Dan had turn the world in a battlefield, Vlad and soon Valerie discover a new carachter to this war, someone who had inherit the old hero protectiveness, but he's only protect one person...

An Endless Division

2009-11-20T22:10:41-08:00

Author: Silver Sleet
Category: Danny Phantom
Language: English, Rated: K+
Genres: Supernatural/Adventure
Chapters: 3, Words: 7,537, Reviews: 5 Updated: 11-20-09 Published: 11-16-09
Status: In-Progress

Have you ever wondered what it would be like to visit the world of your favorite cartoon? The results may not always be what you expect, especially when everyone in that world is after you.

14 out of 15

2009-11-20T21:08:47-08:00

Author: SadieYuki
Category: Danny Phantom
Language: English, Rated: K+
Genres: Hurt/Comfort/General
Pairing: Valerie G. & Danny F.
Chapters: 1, Words: 1,598, Reviews: 9 Published: 11-20-09
Status: Complete

Valerie finds Danny Phantom sitting in the park. She charges up her gun, aims at his back, and then..."I wasn't good enough," he mumbles.

SpecterPhantom

2009-11-20T18:45:01-08:00

Author: pinkyapple3.0
Category: Danny Phantom
Language: English, Rated: T
Genres: Friendship/Adventure
Pairing: Danny F.
Chapters: 1, Words: 308, Reviews: 1 Published: 11-20-09
Status: In-Progress

When a new kid moves to Amity Park, new allies and enemies come with her; looks like Danny has a lot on his plate this year. And what does Vlad want with Danny's new friend?

Gazing Game

2009-11-20T17:52:10-08:00

Author: too enigmatic 2 b urs
Category: Danny Phantom
Language: English, Rated: K
Genres: Romance/Angst
Pairing: Danny F. & Sam M.
Chapters: 2, Words: 2,319, Reviews: 5 Updated: 11-20-09 Published: 10-18-09
Status: Complete

ONESHOT. AU. Sam pondered about her feelings for Danny. A different kind of Danny Fenton. A popularly handsome jerk with a mystery that surrounds him. Written on impulse. DXS

One Shots and Plot Bunnies

2009-11-20T17:02:12-08:00

Author: InvisibleJediMaster
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 5, Words: 6,674, Reviews: 17 Updated: 11-20-09 Published: 9-1-09
Status: Complete

A plotbunny/oneshot collection. Some are adoptable. Fav: Danny doesn't age normally, but even Vlad can't help, so he asks Clockwork. New: Jazz was finally in college. She was nowhere near her hometown of Amity Park. The ghosts should be gone..., right?

The Pain of the Moon

2009-11-20T16:48:25-08:00

Author: serin2
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Supernatural
Pairing: Danny F. & Sam M.
Chapters: 16, Words: 39,599, Reviews: 49 Updated: 11-20-09 Published: 3-1-09
Status: In-Progress

Halfas have the ability to naturally transform, they don't have an obsession caused by death because they never died. What if they gained another form, one that preminates their being. Danny learns a whole new meaning to the best within. DXS

Misty Secret

2009-11-20T14:52:44-08:00

Author: Garnet Sky
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Supernatural
Pairing: Danny F. & Sam M.
Chapters: 5, Words: 5,244, Reviews: 15 Updated: 11-20-09 Published: 10-26-09
Status: In-Progress

Continuing Weeping Wind #10: Quartet. Danny receives an indigo envelope, an invitation to join the Family.

Changes REVISED EDITION

2009-11-20T13:14:25-08:00

Author: Phantom Misfit
Category: Danny Phantom
Language: English, Rated: K
Genres: Romance/General
Pairing: Danny F. & Sam M.
Chapters: 2, Words: 1,696, Reviews: 11 Updated: 11-20-09 Published: 2-10-08
Status: Complete

Sam has a new boyfriend that is trying to change her. Danny and Sam won't have it. Revised 11/4/09

Of Two Enemies

2009-11-20T07:23:52-08:00

Author: Angel Of Darkness Thirteen
Category: Danny Phantom
Language: English, Rated: T
Genres: Sci-Fi/Mystery
Pairing: Danny F. & Sam M.
Chapters: 2, Words: 1,245, Reviews: 0 Published: 11-20-09
Status: In-Progress

A bomb leaves most of the people dead or with amnesia. Two orginizations take the kids in. Then one of the best fighters uncovers a piece of information, and they are all sentenced to die. She escapes with her arch enemy and his friend.Full summary inside

Use Your Imagination

2009-11-19T20:38:28-08:00

Author: DreamTimeTails
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Hurt/Comfort
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 761, Reviews: 5 Published: 11-19-09
Status: Complete

Another perk of being a half ghost. Danny submits to his fantasy by using his clone as a replacement for Vlad, but is it enough? DannyxPretendVlad, yaoi, smut, sad fluff, no suicide or any crap like that.

Life and Death Decisions

2009-11-19T18:08:39-08:00

Author: MetaliHead2x4
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Hurt/Comfort
Chapters: 3, Words: 4,011, Reviews: 4 Updated: 11-19-09 Published: 11-13-09
Status: In-Progress

A normal day begins on an unfamiliar city, ghosts left unmentioned, government and private ghost hunting teams the heroes of their cities as the worlds worst enemy gains what he lost and sees the world from before his life changing accident once more...

Fudge!

2009-11-19T15:05:29-08:00

Author: rose the packs fang
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/General
Pairing: Jack F.
Chapters: 2, Words: 147, Reviews: 11 Updated: 11-19-09 Published: 11-17-09
Status: In-Progress

the dreams of people in Frightmare! R & R! Me Math hunger THIS!

The Kept

2009-11-19T12:50:49-08:00

Author: Twisted Arcana
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Supernatural
Pairing: Danny F. & Sam M.
Chapters: 4, Words: 12,456, Reviews: 9 Updated: 11-19-09 Published: 10-25-07
Status: In-Progress

We were slaves once, forced into the bidding of the Ombra. It's been almost two thousand years since that time, but I fear nothing has changed. Humanity was never free... we simply chose a new master. Something else is at work, and it means to destroy us.

Nichtkinder, Seelekinder

2009-11-19T10:13:03-08:00

Author: Anthiena
Category: Danny Phantom
Language: English, Rated: T
Genres: Horror/Family
Pairing: Danny F. & Vlad M.
Chapters: 2, Words: 6,456, Reviews: 1 Updated: 11-19-09 Published: 7-28-09
Status: In-Progress

Danny's life fifteen years after the meteor is shattered with the murder of his wife Sam, the attack on his seven year old daughter and the re-emergance of two enemies: Phantom and a seemingly reformed Vlad Masters-but is Vlad telling the truth?

The Mind of a Hero

2009-11-19T06:02:30-08:00

Author: Tavalya Ra
Category: Danny Phantom
Language: English, Rated: M
Genres: Drama/Angst
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 1,333, Reviews: 6 Published: 11-19-09
Status: In-Progress

Vlad is determined to have Danny accept him as a father and mentor, but a little mental tampering has extreme results and leaves them both scarred. Seven years later, Danny learns the full consequences of an act for which he can never forgive himself.

Set, Time, Match

2009-11-18T20:52:41-08:00

Author: 9haharharley1
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Romance
Pairing: Dan Phantom & Danny F.
Chapters: 2, Words: 3,759, Reviews: 24 Updated: 11-18-09 Published: 6-10-09
Status: In-Progress

Evil!Dan/Danny BETTER SUMMARY INSIDE. Clockwork makes a deal with Dan and releases him. He's tasked to look after Danny and teach him to use his powers. But Dan starts to remember all the bad stuff that happens to Danny and starts to become protective

Cataclysmos

2009-11-18T17:30:17-08:00

Author: o Mischief Managed
Category: Danny Phantom
Language: English, Rated: T
Genres: Suspense/Spiritual
Chapters: 2, Words: 5,851, Reviews: 1 Updated: 11-18-09 Published: 11-17-08
Status: In-Progress

FullSummInside. The End of the World. It was a story, a legend, told to scare people into acting the way we thought was right. We took advantage of that belief. We started a war. It was never supposed to be real. But it is. And now we can't escape it.

Dani Phantom and the Specter Detectors

2009-11-18T16:21:12-08:00

Author: Ri-kun
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Adventure
Pairing: Dani
Chapters: 2, Words: 22,457, Reviews: 2 Updated: 11-18-09 Published: 11-8-09
Status: In-Progress

Dani Phantom has left Amity Park to strike out on her own. Three years have past as she settles in a new town to find her freedom and live life by her own rules. When three ghost hunters enter the picture, she finds herself in a conspiracy of epic propo

Thesis Statement

2009-11-18T14:12:29-08:00

Author: Shin-Shui
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Tragedy
Pairing: Danny F. & Dan Phantom
Chapters: 3, Words: 8,421, Reviews: 10 Updated: 11-18-09 Published: 10-19-09
Status: In-Progress

Danny's always been the kind of person who thought Twins were a mystical force, and he's also always wanted one. But what happens after he finds out he HAD a twin that died when they were younger? And what about when he meets his brother's ghost?T...Mybe?

Summertime Songs

2009-11-18T09:13:24-08:00

Author: Soulless Warlock
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Humor
Pairing: Sam M. & Danny F.
Chapters: 25, Words: 69,889, Reviews: 24 Updated: 11-18-09 Published: 10-4-08
Status: Complete

Sequel to CH Presents: The Producers. With a rousing cheer of "together, wherever we go", Danny and the gang embark on a summer of romance, music, Disney rejects, and a giant robot. Beta-read and repackaged for your reading enjoyment. Read and Review!

The Return of Dan Phantom

2009-11-17T20:09:45-08:00

Author: Obiwan456
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/General
Pairing: Dan Phantom & Danny F.
Chapters: 1, Words: 502, Reviews: 6 Published: 11-17-09
Status: Complete

A one shot I put together. Dan Phantom returns! Humor.

For the Love of DP!

2009-11-17T17:58:43-08:00

Author: Teira Runes-Klein
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 11, Words: 10,772, Reviews: 5 Updated: 11-17-09 Published: 10-25-09
Status: In-Progress

Welcome to my collection of oneshots and prison for evil plot bunnies! Now Playing: "His Bulter, The Demon" - Something lost can never be returned...

The thing that needed to be said

2009-11-16T19:17:36-08:00

Author: phantomphreak09
Category: Danny Phantom
Language: English, Rated: K
Genres: Humor/General
Chapters: 1, Words: 1,164, Reviews: 5 Published: 11-16-09
Status: Complete

The night started out like any other night. I finished my homework, ate dinner with the family, then watched a little TV and went to bed. Nothing out of the ordinary there, right? Normally I would say yes, but this particular night was different...

Between the Lines of Life

2009-11-16T19:09:27-08:00

Author: Combustionable BioHazard
Category: Danny Phantom
Language: English, Rated: T
Genres: Mystery/Adventure
Pairing: Danny F. & Sam M.
Chapters: 4, Words: 7,756, Reviews: 3 Updated: 11-16-09 Published: 10-29-08
Status: In-Progress

AU. DxS. Rated T for language and violence. Full sum inside. Danny isn't ordinary, and never was. His questions pile up to an extreme level and go up even higher when he meets a certain girl. Now, he's in for the ride of his life...

Confession Problems!

2009-11-16T10:14:11-08:00

Author: Nostalgic5947
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Romance
Pairing: Danny F. & Dan Phantom
Chapters: 18, Words: 15,177, Reviews: 55 Updated: 11-16-09 Published: 11-1-08
Status: In-Progress

The SEQUEL to Twin Problems: Dan has come out about being dead, but the next coming out isn't as easy. Can Dan tell Danny he loves him? Will he even admit it to himself? SLASH/yaoi DPDF others OMG! UPDATED!

Danny's nightmare

2009-11-16T08:43:07-08:00

Author: Mastermindhunter
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Hurt/Comfort
Pairing: Danny F. & Vlad M.
Chapters: 19, Words: 27,721, Reviews: 4 Updated: 11-16-09 Published: 11-2-09
Status: In-Progress

Danny's going out to Indiana to visit his second cousin. He's learned a whole lot of lessons about ghost powers. This trip he's going to learn a lesson about something more important than all those lessons put together. Forgiveness and understanding.

Checkmate

2009-11-16T08:18:46-08:00

Author: pearl84
Category: Danny Phantom
Language: English, Rated: K+
Genres: Adventure/Angst
Pairing: Danny F. & Vlad M.
Chapters: 56, Words: 548,889, Reviews: 1507 Updated: 11-16-09 Published: 4-24-06
Status: In-Progress

Vlad forces Danny to leave everything behind in order to save Jazz. But just when the billionaire believes to have won his chess game against his young rival, Danny makes a single unexpected move. Now, it's anyone's game. But is it about winning anymore?

Clash of All Time

2009-11-16T06:20:14-08:00

Author: R.tistiC
Category: Danny Phantom
Language: English, Rated: K+
Genres: Supernatural/Adventure
Pairing: Dani & Dan Phantom
Chapters: 27, Words: 143,251, Reviews: 208 Updated: 11-16-09 Published: 12-12-08
Status: In-Progress

Soon after the end of events of The Return of Dani Phantom, a long-feared vision of Clockwork's comes to pass. Now the lives of many are endangered and the two Phantom cousins must face The Ultimate Enemy once again.

Daddy's Little Girl

2009-11-16T06:00:14-08:00

Author: mysoulmate
Category: Danny Phantom
Language: English, Rated: M
Genres: Family/Romance
Pairing: Danny F. & Dani
Chapters: 2, Words: 3,779, Reviews: 3 Updated: 11-16-09 Published: 11-1-09
Status: In-Progress

Dani has come back, trouble close at hand. Can Danny convince her to call Amity Park home, well trying to adjust to his new relationship with Dash, Dani's unlikely savour.

Kingdom Come

2009-11-16T05:11:16-08:00

Author: candelight
Category: Danny Phantom
Language: English, Rated: K+
Genres: Tragedy/Hurt/Comfort
Pairing: Vlad M. & Danny F.
Chapters: 6, Words: 7,142, Reviews: 23 Updated: 11-16-09 Published: 9-10-09
Status: In-Progress

Danny/Vlad Fatherson fiction. When Danny’s family and friends are slaughtered in a tragic farce, someone simply will not allow the brokenhearted hybrid to walk alone.

Rejection and Acceptance

2009-11-15T21:22:02-08:00

Author: angel-of-the-obvious
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Humor
Pairing: Danny F. & Sam M.
Chapters: 3, Words: 1,725, Reviews: 5 Updated: 11-15-09 Published: 8-16-09
Status: In-Progress

DISCONTINUED

Tomorrow Comes Today

2009-11-15T21:17:43-08:00

Author: Mimo-Sene
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Mystery
Pairing: Sam M. & Dan Phantom
Chapters: 3, Words: 6,614, Reviews: 37 Updated: 11-15-09 Published: 4-1-07
Status: In-Progress

He noticed her shock and smirked, pulling her to her feet. Her breath caught in her throat when she spotted a flash of affection in his gaze briefly before it was replaced with that arrogant gleam again. DxS TxJ OOC

Poets of Phantom

2009-11-15T21:04:54-08:00

Author: angel-of-the-obvious
Category: Danny Phantom
Language: English, Rated: T
Genres: Poetry/General
Chapters: 3, Words: 80, Reviews: 0 Published: 11-15-09
Status: In-Progress

A series of poems about the cast-past, present and future. 3rd poem up!"In darkness, I hide Framed by this dark world Desire and obsession from within..."

Hard To Say

2009-11-15T19:44:16-08:00

Author: NINJA-RENKA
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Romance
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 7,694, Reviews: 3 Published: 11-15-09
Status: Complete

-Sequel to "A Little Perspective"- Danny is getting ready to go to college, and has said goodbye to all of his friends and family. Although there’s still one person that he has yet to say goodbye to. DANNY/VLAD -PART TWO OF THREE-

Thunderstorms

2009-11-15T18:58:30-08:00

Author: Double I 4 My Guyz
Category: Danny Phantom
Language: English, Rated: K+
Genres: Romance/Friendship
Pairing: Sam M. & Danny F.
Chapters: 1, Words: 977, Reviews: 3 Published: 11-15-09
Status: Complete

Sam is terrified of thunderstorms. While she is lying terrified in her room, Danny shows up. And he knows just how to make her feel better. DXS

Gone

2009-11-15T16:53:06-08:00

Author: Dasi Miotti
Category: Danny Phantom
Language: English, Rated: T
Genres: Angst/Adventure
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 1,113, Reviews: 2 Published: 11-15-09
Status: In-Progress

Tucker is gone, and Danny's life has been spiraling down ever since. After a year of no Phantom, a thought-to-be vanquished enemy returns for bloodthirsty revenge. Can Danny handle it? Rated T just in case I get Danny and Sam together. Giggity.

Ways Vlad Get Maddie and Danny

2009-11-15T16:04:16-08:00

Author: XxKobu71062xX
Category: Danny Phantom
Language: English, Rated: T
Genres: Family/General
Pairing: Vlad M.
Chapters: 1, Words: 3,804, Reviews: 1 Published: 11-15-09
Status: In-Progress

Many one shots. Many ways Vlad will have Maddie and Danny as his family. Some of them will have a few things in them. Some will be T and some will be M. Read and Review, no flames.

With Love

2009-11-15T15:40:08-08:00

Author: IrisPhantom
Category: Danny Phantom
Language: English, Rated: M
Genres: Romance/Drama
Pairing: Vlad M. & Maddie F.
Chapters: 3, Words: 3,529, Reviews: 6 Updated: 11-15-09 Published: 9-20-09
Status: In-Progress

It was Valentines day...Vlad Masters was once again, alone. Forced to play chess with his cat, Maddie, as his mind wandered. Then came a knock at the door... I do not own Danny Phantom, no matter how much I want to... Half credit to CrackPairingAddict.

Small Wonders

2009-11-15T14:45:51-08:00

Author: Ever Changing Dream
Category: Danny Phantom
Language: English, Rated: K+
Genres: Supernatural/Family
Pairing: Vlad M.
Chapters: 2, Words: 5,977, Reviews: 4 Updated: 11-15-09 Published: 9-19-09
Status: In-Progress

The smallest thing can sometimes be the most powerful, at least that's what Vlad discovers when he's forced to take care of a two year old half ghost. But can he raise him properly or will the ghost responsible for this end him... permanently.

Can Of Worms

2009-11-15T14:31:53-08:00

Author: PhantomInvader
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/General
Pairing: Danny F.
Chapters: 1, Words: 1,844, Reviews: 2 Published: 11-15-09
Status: In-Progress

Sequel to SC. When Riley enters Casper High as a freshman and a ghost attack results in her learning Danny's secret, she swears not to tell. Danny knows Riley works very hard to keep her promises, but exactly how good is she at keeping secrets? Slight DxS

Lights, Camera, Action!

2009-11-15T14:10:52-08:00

Author: Skating Queen
Category: Danny Phantom
Language: English, Rated: K+
Genres: General/Adventure
Pairing: Danny F.
Chapters: 17, Words: 30,534, Reviews: 225 Updated: 11-15-09 Published: 11-17-07
Status: In-Progress

A movie director comes to Amity Park and wants Danny Fenton to play the part of Danny Phantom. In a turn of events, Danny's whole life changes dramatically from starting lose his powers, to somebody, and maybe the whole world, possibly knowing his secret

Turn Back the Clock

2009-11-15T13:15:39-08:00

Author: DPcrazy
Category: Danny Phantom
Language: English, Rated: K+
Genres: Drama/Angst
Pairing: Clockwork & Danny F.
Chapters: 10, Words: 16,813, Reviews: 75 Updated: 11-15-09 Published: 8-4-09
Status: Complete

Clockwork has a decision to make. As usual, he must choose the lesser of the two evils. However, the lesser may involve turning back the clock of a certain someone, turning him back into a teen. Meeting this person might just drive Danny insane.

Birth of a Hero

2009-11-15T04:53:56-08:00

Author: Completely Different
Category: Danny Phantom
Language: English, Rated: K
Genres: General
Pairing: Clockwork & Danny F.
Chapters: 1, Words: 650, Reviews: 2 Published: 11-15-09
Status: In-Progress

Clockwork witnesses the birth of a boy destined to change both worlds. One-shot.

One Month

2009-11-14T22:36:31-08:00

Author: Mystical Si
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Friendship
Chapters: 23, Words: 49,218, Reviews: 130 Updated: 11-14-09 Published: 10-2-09
Status: In-Progress

There was one month between the Accident and the encounter with the Lunch Lady. One month of Danny trying to get the hang of his powers. One month of Sam and Tucker doing everything they could to help their recently half-deceased best friend. Hinted DxS

A Beautiful Death is EightThousand Years Long

2009-11-14T21:36:39-08:00

Author: Eddie Striker
Category: Danny Phantom
Language: English, Rated: M
Genres: Angst/Romance
Pairing: Vlad M.
Chapters: 1, Words: 1,922, Reviews: 2 Published: 11-14-09
Status: Complete

We’re all used to hearing Danny’s side of TUE, but what about Vlad? What kind of mental torture did he go through? M for one-sided homosexual love, paedophilia and rape

Twilight's Doors

2009-11-14T12:07:59-08:00

Author: Garnet Sky
Category: Danny Phantom
Language: English, Rated: K+
Genres: Supernatural/Friendship
Pairing: Danny F. & Sam M.
Chapters: 2, Words: 2,184, Reviews: 10 Updated: 11-14-09 Published: 10-26-09
Status: In-Progress

Spying on a girl can lead to interesting results.

Vegetable Skull

2009-11-14T12:04:25-08:00

Author: Garnet Sky
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Hurt/Comfort
Pairing: Danny F. & Valerie G.
Chapters: 4, Words: 3,001, Reviews: 11 Updated: 11-14-09 Published: 10-26-09
Status: In-Progress

Chapter titles have nothing to do with the story. Valerie Worth owns "Pumpkin". This story is currently out of control--just in time for Halloween.

The Look

2009-11-14T10:32:19-08:00

Author: xAstroBoyx
Category: Danny Phantom
Language: English, Rated: K
Genres: Romance/General
Pairing: Danny F. & Sam M.
Chapters: 4, Words: 1,505, Reviews: 1 Updated: 11-14-09 Published: 11-13-09
Status: In-Progress

Sam has been giving Danny this strange look and he wants to get to the bottom of it. DxS This is my first story by the way. xD

guess Who's Back

2009-11-13T19:17:32-08:00

Author: I'm-paranormal33
Category: Danny Phantom
Language: English, Rated: T
Genres: Humor/General
Pairing: Sam M. & Danny F.
Chapters: 1, Words: 1,636, Reviews: 3 Published: 11-13-09
Status: In-Progress

Danny and Sam's first day back to school after the disasteroid. read my other stories to understand this 1. I know it mite suck, but i wanted 2 get it out of the way

Batman & Robin

2009-11-13T19:09:41-08:00

Author: Mystique97
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Humor
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 1,503, Reviews: 4 Published: 11-13-09
Status: Complete

DXS and slight TXV halloween oneshot. Sam shows her stuff on halloween night. R&R please

Lucky 13

2009-11-13T18:27:37-08:00

Author: Donteatacowman
Category: Danny Phantom
Language: English, Rated: K+
Genres: Romance/Humor
Pairing: Johnny 13 & Kitty
Chapters: 1, Words: 650, Reviews: 1 Published: 11-13-09
Status: Complete

It's Friday the 13th, and you know what that means!: Johnny 13/Kitty fluff. Kitty takes Johnny to a secret location. Kissing ensues! And also a bit of ghostly mayhem, 'cause really, what's the fun without that?

Ghost Zone Experience

2009-11-13T14:36:40-08:00

Author: Dream Trance
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/General
Pairing: Danny F. & The Box Ghost
Chapters: 3, Words: 10,026, Reviews: 33 Updated: 11-13-09 Published: 11-5-09
Status: In-Progress

“Why am I even here? I’m a weatherman, not a—Good afternoon, Amity Park! This is Lance Thunder bringing you live to what looks like a ghostly tug-a-war with our own town hero,Danny Phantom, as the rope and opposition. Anything you’d like to add, Mr. Phan?

Breaking the Block

2009-11-13T14:00:13-08:00

Author: Writer's-BlockDP
Category: Danny Phantom
Language: English, Rated: K+
Genres: General/Humor
Chapters: 7, Words: 6,763, Reviews: 28 Updated: 11-13-09 Published: 11-9-07
Status: In-Progress

My way of breaking out of my namesake. The latest: Oh I Wish - Maddie wakes up in the middle of the night and makes a startling discovery

Invalid

2009-11-13T13:26:21-08:00

Author: at-a-glance
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Angst
Chapters: 16, Words: 54,567, Reviews: 72 Updated: 11-13-09 Published: 10-24-08
Status: In-Progress

AU. Danny Fenton he was just fourteen, young enough to be naive, young enough to die. Who could have foreseen what would come of just one mistake.

Phantom's Secret Diary

2009-11-13T10:40:03-08:00

Author: Anthiena
Category: Danny Phantom
Language: English, Rated: T
Genres: Humor/Romance
Pairing: Danny F. & Jazz F.
Chapters: 2, Words: 3,431, Reviews: 4 Updated: 11-13-09 Published: 10-28-09
Status: In-Progress

YAOI - Jazz oversteps a boundary and Danny relates the Christmas Party where he sees a bespeckled someone. Not Poindexter, either. Rated for language, adult situations, et cetera. DON'T LIKE, DON'T READ.

Remember Me?

2009-11-13T00:44:25-08:00

Author: phantomphreak09
Category: Danny Phantom
Language: English, Rated: K
Genres: Family/Hurt/Comfort
Chapters: 1, Words: 1,474, Reviews: 0 Published: 11-13-09
Status: In-Progress

He looked at me quizzically, his head tilted slightly to the left as he contemplated. Then, when I was about to lose hope, his face suddenly brightened and he uttered one word. “Phantom!”

Title, You Decide!

2009-11-12T21:01:44-08:00

Author: CrazyDentist-LuVeR
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Pairing: Danny F.
Chapters: 1, Words: 1,503, Reviews: 2 Published: 11-12-09
Status: In-Progress

Here is the first chapter to a challenge fic! Now I need you, the readers, to tell me what's going to happen next! The story will progress as such, so the more you review, the faster and better this will be! Also, title ideas?

Here's to the Hero!

2009-11-12T17:42:22-08:00

Author: Artgirl4
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Pairing: Danny F.
Chapters: 37, Words: 41,288, Reviews: 329 Updated: 11-12-09 Published: 2-7-08
Status: In-Progress

My own collection of little one-shots and drabbles for Danny Phantom. Never anything gruesome, angsty, depressing, tragic, and no character deaths! Might include a few previews of my stories-to-come! R&R!

Ghostly Dominion

2009-11-12T04:13:00-08:00

Author: Eidorian999
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 2, Words: 2,274, Reviews: 2 Updated: 11-12-09 Published: 9-25-09
Status: In-Progress

The Earth has fallen. Not to Pariah Dark, or Vlad Plasmius, or even Dark Dan. Instead, it has fallen to 11 of the most powerful ghosts in the ghost zone. The Ghost Lords. Heartmann city is the last stronghold left...

Return of Phantom

2009-11-12T04:12:33-08:00

Author: Eidorian999
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Chapters: 8, Words: 25,580, Reviews: 19 Updated: 11-12-09 Published: 8-25-09
Status: In-Progress

My take on what would have happened if Clockwork hadn't saved Danny's family and friends from the Nasty Burger explosion. Set five years after Tue.

Obsessions

2009-11-12T00:43:23-08:00

Author: Celestial Fey
Category: Danny Phantom
Language: English, Rated: T
Genres: Angst/Friendship
Chapters: 5, Words: 8,438, Reviews: 22 Updated: 11-12-09 Published: 10-11-09
Status: In-Progress

AU. Clockwork didn't save Danny's family and friends in TUE, and Danny only had time to save Sam and Tucker. Mourning the loss of his family and trying to prevent himself from turning evil, Danny desperately clings to the only two people he has left. DxS

The Way We Celebrate

2009-11-11T23:39:50-08:00

Author: Clier
Category: Danny Phantom
Language: English, Rated: M
Genres: General
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 5,849, Reviews: 4 Published: 11-11-09
Status: In-Progress

Vlad kidnaps Danny the night of his nineteenth birthday.... What's the man's intent? It's a smut story, folks--what do you think? Rated appropriately for exactly what you think is in here.

Danny, Dan, and Daniel

2009-11-11T21:22:45-08:00

Author: Paladin of Farore
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Adventure
Pairing: Danny F. & Sam M.
Chapters: 29, Words: 71,053, Reviews: 225 Updated: 11-11-09 Published: 2-24-09
Status: Complete

PostPP: After the disasteroid Danny slowly gets used to being a known superhero, and dating Sam but then his two futures enter the picture, Now he must fight along side Daniel his good future self and defeat Dan once and for all or watch all he loves die

The Siege

2009-11-11T20:54:00-08:00

Author: Kellie Fay
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Chapters: 15, Words: 31,623, Reviews: 28 Updated: 11-11-09 Published: 7-12-07
Status: In-Progress

Danny’s favorite teacher has been exposed at school as a sorceress and has a hoard of angry parents at her doorstep. Can Danny protect his teacher and his classmates without being exposed himself?

You See What Chocolate Can Do To You?

2009-11-11T20:49:39-08:00

Author: Mischievia SamanthaFenton
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor
Chapters: 2, Words: 1,445, Reviews: 13 Updated: 11-11-09 Published: 9-15-09
Status: Complete

I got chocolate, went crazy and here it is!

Just Sam

2009-11-11T18:03:23-08:00

Author: Readergirl21
Category: Danny Phantom
Language: English, Rated: K
Genres: General
Pairing: Sam M. & Danny F.
Chapters: 1, Words: 235, Reviews: 5 Published: 11-11-09
Status: Complete

One-Shot::; Sam's thoughts on Danny before Phantom Planet. Short short. :

Phantom Shots

2009-11-11T16:51:39-08:00

Author: Teribane
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Pairing: Danny F.
Chapters: 1, Words: 436, Reviews: 3 Published: 11-11-09
Status: In-Progress

A collection of oneshots, drabbles, plot bunnies, plot coyotes, corssover shots... Rated for safety. Some shots may be T, some K, etc. No M.

Same Differences

2009-11-11T13:54:14-08:00

Author: Lost In The Lies
Category: Danny Phantom
Language: English, Rated: K+
Genres: Family/Hurt/Comfort
Pairing: Dani & Danny F.
Chapters: 1, Words: 1,846, Reviews: 1 Published: 11-11-09
Status: Complete

When you haven't seen somebody for years, there are differences to be seen. What would it be like if that person was your clone? - One-shot

The Next Phantom

2009-11-11T05:36:24-08:00

Author: Spectral Ninja
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/General
Pairing: Danny F.
Chapters: 1, Words: 1,350, Reviews: 4 Published: 11-11-09
Status: In-Progress

Jason Daniel Fenton thought his life was hard enough. Not hard enough though. His dad decides to move to Amity Park and it leads Jason to a whole new world of chaos. Phantom Planet never happened. Parents of DP know.T cause I'm afraid

Roller Skating

2009-11-11T03:47:40-08:00

Author: Mystique97
Category: Danny Phantom
Language: English, Rated: K+
Genres: Romance/Humor
Pairing: Danny F. & Sam M.
Chapters: 1, Words: 2,013, Reviews: 3 Published: 11-11-09
Status: Complete

A good sized one-shot about Danny and Sam. DXS and TXV. R&R Please

To Loose the Fateful Lightning

2009-11-10T23:19:16-08:00

Author: Graywand
Category: Danny Phantom
Language: English, Rated: T
Genres: Adventure/Sci-Fi
Pairing: Sam M. & Jazz F.
Chapters: 2, Words: 5,804, Reviews: 1 Updated: 11-10-09 Published: 10-15-09
Status: In-Progress

The world has changed. 90 days have passed since the world was saved, and the GIW have been dissolved for incompetence. The world turns to humanity's newest heroes to build a new armed force to fill the void, which, armed with a new discovery they do.

Danny Phantom: The Door of Ages

2009-11-10T17:14:48-08:00

Author: Cantdecideonaname
Category: Danny Phantom
Language: English, Rated: K+
Genres: Adventure
Pairing: Danny F.
Chapters: 53, Words: 68,717, Reviews: 125 Updated: 11-10-09 Published: 6-6-08
Status: In-Progress

-Sequel to DPVR- Danny and friends embark on another journey to find the mysterious Door of Ages. The team encounters foes old and new as they search for the key that could lead to ultimate treasure... or to a dark fate.

Alternate Timeline: Phantom & Angel

2009-11-10T16:25:18-08:00

Author: Kenzy-Chan
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Adventure
Pairing: Danny F.
Chapters: 21, Words: 435,143, Reviews: 91 Updated: 11-10-09 Published: 5-30-08
Status: In-Progress

PostPP Danny is on the edge. With his newfound awkward popularity, onslaught of ghost attacks and crumbling relationship with Sam; Tucker suggests that the Halfa take a vacation. Where else would he go to but Clockworks to watch some other timelines? DPJL

Drabble 101

2009-11-10T15:48:23-08:00

Author: Phantom Shadow Pirate
Category: Danny Phantom
Language: English, Rated: T
Genres: General
Chapters: 19, Words: 10,115, Reviews: 40 Updated: 11-10-09 Published: 1-13-07
Status: In-Progress

A series of 101 drabbles. Please Read and Review! I don't own anything!

The Great Experiment

2009-11-10T11:01:57-08:00

Author: Kagome51
Category: Danny Phantom
Language: English, Rated: K+
Genres: Drama/Angst
Pairing: Danny F.
Chapters: 7, Words: 16,416, Reviews: 170 Updated: 11-10-09 Published: 4-22-09
Status: Complete

Based on one of Cordria's Nova Shot's. They had him, they finally had him. But he is nothing like they expected. So, what do you do with a ghost boy who is more boy than ghost?

A Little Perspective

2009-11-10T04:44:43-08:00

Author: NINJA-RENKA
Category: Danny Phantom
Language: English, Rated: T
Genres: General/Romance
Pairing: Danny F. & Vlad M.
Chapters: 1, Words: 5,917, Reviews: 9 Published: 11-10-09
Status: Complete

When Danny and Sam have a bad fight, the young halfa gets some advice and comfort from an unlikely source. DANNY/VLAD -PART ONE OF THREE-

Chains of Existence

2009-11-09T23:53:09-08:00

Author: Celestial Fey
Category: Danny Phantom
Language: English, Rated: T
Genres: Supernatural/Friendship
Chapters: 3, Words: 5,861, Reviews: 19 Updated: 11-9-09 Published: 10-26-09
Status: In-Progress

Heavy AU. A Psychic Link, the ghost of a boy who was never born, a goth girl who sees ghosts and a technogeek suspicious that his best friend is being haunted. What could have been, but wasn't supposed to be. DannyxSam, minor TuckerxJazz

You Know You're Obsessed With Danny Phantom If

2009-11-09T16:53:15-08:00

Author: Princess of Rose
Category: Danny Phantom
Language: English, Rated: K+
Genres: Humor/General
Chapters: 10, Words: 4,007, Reviews: 75 Updated: 11-9-09 Published: 11-10-08
Status: In-Progress

Sometimes obsession goes too far. You may need to go to rehab if you do some of these... please r&r OFF HIATUS YAYS

Memories

2009-11-09T16:44:38-08:00

Author: MutantLover09
Category: Danny Phantom
Language: English, Rated: T
Genres: Drama/Suspense
Chapters: 14, Words: 65,809, Reviews: 247 Updated: 11-9-09 Published: 12-1-08
Status: In-Progress

You cherish them. You hate them. They consume your day dreams and remind you of all the past experiences in life; great, small, blissful, and embarrassing. Memories. Every human has them ... except one. Danny Phantom/Teen Titans crossover.

The Brotherhood

2009-11-09T12:02:07-08:00

Author: MiserablyEverAfter
Category: Danny Phantom
Language: English, Rated: T
Genres: Romance/Supernatural
Pairing: Tucker F. & Jazz F.
Chapters: 2, Words: 5,481, Reviews: 4 Updated: 11-9-09 Published: 8-24-09
Status: In-Progress

Tucker is tired of being taken for granted on Team Phantom, so when Jazz invites him to join a group of highly trained ghost hunters, he feels he has no choice but to accept. TxJ

Phantom's Fables

2009-11-09T11:29:37-08:00

Author: F-35 Phoenix
Category: Danny Phantom
Language: English, Rated: K+
Genres: General
Chapters: 2, Words: 598, Reviews: 6 Updated: 11-9-09 Published: 11-8-09
Status: In-Progress

A oneshot series revolving around Aesop's Fables. #2: The Scorpion and the Frog.